PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre07.g319701.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 443aa    MW: 45684.5 Da    PI: 6.8952
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre07.g319701.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.51.3e-163969131
                GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31
                        C+ Cg+t+Tp+WR+gp g+ktLCnaCG++ +
  Cre07.g319701.t1.2 39 CVECGATSTPQWREGPMGPKTLCNACGVRRQ 69
                        ***************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.8733366IPR000679Zinc finger, GATA-type
SMARTSM004014.2E-113384IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-123473No hitNo description
Gene3DG3DSA:3.30.50.103.5E-133769IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.48E-113967No hitNo description
PfamPF003201.2E-133967IPR000679Zinc finger, GATA-type
PROSITE patternPS0034403964IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MSMRNNKRRA LASAGAASKQ SAVADAVLDV ANRKGVRCCV ECGATSTPQW REGPMGPKTL  60
CNACGVRRQR LIRKQQAAVA GVTPTAPVAA VQARRRLATR RRPGASASLI ADEDVFAPAG  120
AGSVSEQSSD EAEMTVMGWR TTAAEVPRPQ RGQHSAATGT DVEDSCNEEE TAAYDLLFFA  180
GFDCGDYGYS APSGPSHGHN TRRQAAPQRR SDDFYYYEEQ DHEGEHGVAA GEHERLPMSA  240
PALQQVSSIK RRRVLAAPPK VHIRPGRSAM TSFPSSSAEH EAAAVPAVSN MSSLPAAAGP  300
APASSSDAAT AELLPAAPAV LPSSAMLALQ LPLLPLALPA LSLPGAVVAG GASPADLEMI  360
AALHAEFQRA CMQMQQAVAA AEAVGAVAAE RRDAADAAHA VAAVASQRLA DGAKVVAALP  420
EVRDVLAELH TGPVAMAVAP PL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1249253KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.38931e-125normal conditions| nutrient deficiency
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre07.g319701.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.15e-13GATA transcription factor 9